PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF007400020CFD_t1
Common NameTRAES_3BF007400020CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Nin-like
Protein Properties Length: 933aa    MW: 102241 Da    PI: 6.1761
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF007400020CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29583634152
                   RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              aek+isle+l++yFs+++k+AAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  TRAES3BF007400020CFD_t1 583 AEKTISLEVLQQYFSGSLKNAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 634
                              589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.643573654IPR003035RWP-RK domain
PfamPF020423.3E-26586634IPR003035RWP-RK domain
SuperFamilySSF542774.91E-22830923No hitNo description
Gene3DG3DSA:3.10.20.2401.2E-25839920No hitNo description
PfamPF005645.8E-15839920IPR000270PB1 domain
PROSITE profilePS5174519.189839921IPR000270PB1 domain
SMARTSM006662.2E-24839921IPR000270PB1 domain
CDDcd064071.00E-33840920No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 933 aa     Download sequence    Send to blast
MDIDPSSVSH ADGGGDLWPF DSLTTSLFFS SVSSSPPLHP LPVASSSWLT PPSPLWLFED  60
RQMMPIEVGP APAAAPDNTA AVAEEAQRAR SGNSDTPIKK TERLNNKWQF NLALHDDSTN  120
SSCLFKEKLT HALRYFKEST DQHLLVQVWA PVKSGDRYVL TTSGQPFVLD HQSIGLLQYR  180
AVSMMYMFSV DGDNAGELGL PGRVYKQKVP EWTPNVQYYS STEYPRLNHA ISYNVHGTVA  240
LPVFDPSVQS CIAVVELIMT SKKINYADEV DKVCKALEAV NLKSTEILEH PNVQICNEGR  300
QSALVEILEI LTVVCEEHKL PLAQTWVPCK YRSVLAHGGG VKKSCLSFDG SCMGEVCMST  360
SDVAFHVIDA HMWGFRDACV EHHLQKGQGV SGKAFIYHRP CFSKDISQFC KLEYPLVHYA  420
RMFGLAGCFA ICLQSPYTGD DYYMLEFFLP PSCKEEDDQN ALLESILGLI NQCLRNLKVA  480
GNGESNKASL QLSNVIMIES EDFKTNVHFE NSEGFRESPE GETHGGAHEF DKANSKVSEG  540
HLLADDNSHN NGVSVSRPNG SAASDSSLLH KNGKPPERRR GKAEKTISLE VLQQYFSGSL  600
KNAAKSLGVC PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKQVIESVQG SDAAFNLTSI  660
TGPLPTIPVG PSSDSFNKEK ASESKAEHSN RAVDGDRDSS LQKSQETGSH FGALMSQQGF  720
ADTGNNVQLE ADKASLSRSS SGEGSINSRT SEGSCQGSPA NQTFVCQPIA SMFLEPQEPQ  780
LNPEGFTKEP FQEPELPLSR MLIEDSGSSK DLKNLFGSAI GQPMLAPPSN FGPMRNSGTV  840
TIKASFKEDI VRFRFPCSSS VMALKDEVAK RLRMDAGMFD IKYLDDDHEW VKLACNADLE  900
ECIEISRHSG THVIRLLVSD VAAHIGSSCG SSG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565547.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLW5CVV50.0W5CVV5_WHEAT; Uncharacterized protein
STRINGBRADI2G08177.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]